<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK5004 TK5004b Denmark 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT 110
2 None 115
3 3TC+ AZT 22
4 3TC+ AZT+ SQV 58
5 3TC+ AZT+ IDV 15
6 3TC+ D4T+ NFV 22
7 3TC+ AZT 27
8 None 36
9 3TC+ AZT+ EFV 59
10 IDV+ LPV+ RTV 56
11 3TC+ D4T+ EFV 13
12 D4T+ EFV+ DDI+ LPV+ NFV 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54AV, V82A L89IV L10I, V11VL, I13V, K14R, I15IV, K20I, E35D, M36I, R41K, H69K, K70R, A71AT  
>TK5004b| codons 1-99
PQITLWQRPILTVRVGGQLIEALLDTGADDTVLEDINLPGKWKPKMIVGIGGFAKVRQYD
QILIEICGKRTIGTVLVGPTPANIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103KN   P4S, E6D, E28EA, K32E, V35I, T39K, K43E, E44D, V118I, K122E, D123S, I135T, S162C, K173T, Q174K, Q207A, R211N, V245E, E291D, I293V, E312T  
>TK5004b| codons 1-324
PISSIDTVPVKLKPGMDGPKVKQWPLTAEKIEALIEICKELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLWNWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDVVPLTEEAE
LELAENREILKTPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005