<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1846 CA4950 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 30
2 AZT+D4T 52
3 AZT+DDI 22
4 3TC+AZT+DDI+SQV 13
5 D4T+IDV 17
6 3TC+D4T+IDV 70
7 DDI+NFV+NVP 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75M, T215F K219Q Y181C, G190A A98G K20R, V35L, T39A, K43E, V60I, D86E, V118I, I135V, S162D, V179VI, G196E, E203K, R211K, F214L, L228H, A272P, T286A, I293V, Q334L, G335S, R358K, A371AV, A376T, T386I, A400T, E432D, V467I, T470P, L491S, T497S, A554S K259K*RW, K287KE
>CA4950| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICAELEEEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQEFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIII
CQYMDDLYVASDLEIEQHRTKIKELRQHLLKWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQWLVGKLNWASQIYPGIKVKQLCKLLRGAEALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLSQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEVVQKITTESIVIWGKIPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVISLPDTTNQKTELQ
AIHLALQDSGSEVNIVSDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L10F K20I, E35D, M36I, L63P, A71V, I72T  
>CA4951| codons 1-99
PQITLWQRPFVTIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVTGTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009