<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK5002 TK5002 Denmark 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ NFV 189

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V K219Q   A98G K11T, V35T, E40D, K49R, V60I, K122E, D123S, I135T, S162A, T165I, K173S, D177E, V179I, Q207A, R211S, F214L, D218E, V245Q, A272P, E291D, I293V, P294T, E312D, D324E  
>TK5002| codons 1-324
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMIKILEPFRSQNPEIII
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVVTLTEEAE
LELAENREILKDPVHGVYYDPSKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S L10F I13V, K14R, I15V, K20T, E35D, M36I, R41K, K45R, R57K, H69K, L89I  
>TK5002| codons 1-99
PQITLWQRPFVTVRVGGQLTEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRSILTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005