<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4018 TK4018 Denmark 2000 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 65
2 3TC+ AZT+ IDV 8
3 3TC+ IDV+ D4T 9
4 None 58
5 3TC+ D4T+ IDV 30
6 NFV+ 3TC+ D4T 63

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215TS, K219Q     V35I, I47L, V60I, T69TA, K103R, D121H, K122E, I135T, D177E, T200I, Q207E, R211K, V245K, D250DE, S251I, A272S, L282C, T286A, I293V  
>TK4018| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKLSKIGPENPYNTPI
FAIKKKNSARWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGFSTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKEIWTVNDIQKLVGKLNWASQIYSGIKVKQLCKCLRGAKALTEVVPLTEEAE
LELAENREILKEPV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, I54IV   K20KR, E35D, M36I, N37E, R41K, Q61HN, I62IV, L63LP, I64V, C67Y, H69Y  
>TK4018| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADNTVLEDIELPGKWKPKMIGGIGGFVKVRQYD
HVPVEIYGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005