<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4017 TK4017 Denmark 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV+ RTV 7
2 None 1
3 3TC+ ABC+ AZT 91

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, M36I, R41K, L63P, H69K, I93L  
>TK4017| codons 1-99
PQITLWQRPLVSIKVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W T215N   E138K V35T, T39G, K43R, A98S, K122E, D123S, A158S, S162A, K173A, D177E, T200A, Q207E, R211K, V245Q, A272P, T286A, E291D, V292I  
>TK4017| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICGELEREGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFNTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005