<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4016 TK4016a Denmark 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 208
2 3TC+ AZT+ IDV+ RTV 66
3 None 50
4 3TC+ AZT+ IDV+ RTV 1
5 3TC+ AZT+ EFV 49

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, L210W T215C K103N   I31R, V35I, K49R, V60I, K101Q, K122E, D123S, I135L, D177E, I178M, T200A, Q207E, V245K, D250E, A272P, L282C, L283I, T286A, I293V, D324E, Q334R  
>TK4016a| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKRKALIEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWRWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCIRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G73S, L89V T12E, K14R, I15V, L19I, R41K  
>TK4016a| codons 1-99
PQITLWQRPLVEIRVGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAISTVLVGPTPVNIIGRNVLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005