<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4016 TK4016 Denmark 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 106

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, L210W, T215Y       I31R, V35I, K49R, V60I, K122E, D123S, I135L, D177E, I178M, T200V, Q207E, R211K, V245E, D250E, A272P, L282C, L283I, T286A, I293V, D324E, Q334R  
>TK4016| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKRKALIEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRVKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCIRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, I13IV, K14KR, I15V, G16GE, L19LI, R41K  
>TK4016| codons 1-99
PQITLWQRPLVAVRVEGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005