<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1844 CA4948 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 37
2 DDI 23
3 AZT 9
4 3TC 43
5 AZT+ IDV 15
6 DDI+ AZT+ IDV 6
7 DDI+ AZT+ 3TC+ IDV 53

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F       S68G, K122E, I135T, I142V, T200TA, V245M, T286TA, A288S, T290TA, I293V K275KN, K287KM
>CA4948| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGINVKQLCKLLRGAMSLAEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L10LF, G73S E35D, M36I, R57K, I62V, L63P, A71X  
>CA4949| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKXISTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005