<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4015 TK4015 Denmark 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ EFV 42
2 3TC+ AZT+ TDF + NFV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML   I13V, K14R, G17E, K20I, E35K, M36I, R41K, I66IF, H69K, L89M  
>TK4015| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLEKINLPGKWKPKLIGGIGGFIKVRQYD
QILIEFCGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   V35T, E36D, V90VI, K122KE, D123DE, I135V, A158AS, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, V245T, E248ED, K281R, T286A, E291D, V292I, I293V, S322T, I326V  
>TK4015| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005