<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4013 TK4013 Denmark 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ RTV+ SQV 6
2 3TC+ RTV+ SQV+ D4T 17
3 3TC+ RTV+ D4T 186
4 3TC+ RTV+ NFV+ AZT 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E6EA, K11KN, K20R, V21I, V35T, T39M, K103KQ, K122E, D123N, K173AT, Q174K, D177E, V179I, T200A, I202V, Q207A, R211S, V245Q, E248H, A272P, T286A, E291D, I293V, E312N T165IM
>TK4013| codons 1-320
PISPIATVPVNLKPGMDGPRIKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKQKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAKNPEIII
YQYVDDLYVGSDLEIGQHRAKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPHKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDVVPLTEEAE
LELAENREILKNPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, E35D, M36I, R41K, R57K, H69K, L89M  
>TK4013| codons 1-99
PQITLWQRPLVTVRVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005