<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4011 TK4011 Denmark 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC+ SQV 27
2 3TC+ D4T+ RTV 96
3 ABC+ DDI+ NFV 34
4 ABC+ DDI+ EFV+ IDV+ RTV 59
5 None 28
6 ABC+ DDI+ EFV+ IDV+ RTV 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M Q58E, G73S L10V, T12S, I15V, L19I, K20R, M36I, L63P, H69K, A71V, I72L, I93L  
>TK4011| codons 1-99
PQITLWQRPVVSIKVGGQIREALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVREYD
QIPIEICGKKVLSTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215Y A62V, K219E V106M, G190A   P4S, T7P, V35T, E36A, T39D, E44D, K122E, D123E, S162Y, K173T, Q174K, N175Y, D177E, V179I, T200A, E203D, Q207E, H208Y, R211K, W212R, H221Y, L228H, V245Q, D250E, A272P, E291D, V292I, E297K  
>TK4011| codons 1-324
PISSIEPVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDELEKDGKISKIGPENPYNTPV
FVIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKYPEIII
YQYVDDLYVASDLEIGQHRAKIDELREYLLKRGFYTPDEKYQKEPPFHWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIIPLTKEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005