<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4010 TK4010 Denmark 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T 5
2 3TC+ AZT 10
3 3TC+ AZT+ RTV+ SQV 4
4 None 106
5 3TC+ AZT+ NFV 9
6 None 3
7 3TC+ D4T+ NFV 41

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, I15V, K20T, E35D, M36I, R41K, R57K, L63P, H69K, V77I, L89M  
>TK4010| codons 1-99
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, K49R, V60I, K122E, D123N, I135T, E169D, Q174K, D177E, I178M, T200I, Q207E, R211K, I244V, V245Q, E248DN, A272P, K277R, L282C, P294ST G152GV, V317Y
>TK4010| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQVWKGSPAIFQSSMTKILDPFRKKNPEMVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCLRGTKALTEVISLTEEAE
LELAENREILKEPVHGYYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005