<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4007 TK4007 Denmark 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ NFV 14
2 3TC+ NFV+ D4T 7
3 3TC+ NFV+ AZT 157
4 3TC+ AZT+ EFV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N K238KT V21VI, V35T, I50V, V118I, K122E, D123NS, I135T, I142V, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S, F214L, V245Q, V261I, A272T, K281R, L283I, I293V, P294T, E312D K277KE
>TK4007| codons 1-324
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKEGKISKVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDTWT
VQPIQLPEKDSWTVNDIQKLIGKLNWASQIYTGIKVEQLCRLIRGTKALTEVVTLTEEAE
LELAENREILKDPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I   I13V, E35D, M36I, R41K, R57K, L63P, H69K, A71AV, L89T  
>TK4007| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVKQYD
QIPIEICGKKVIGTVLVGPTPVNIIGRNTLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005