<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4004 TK4004 Denmark 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 164
2 ABC+ D4T+ NVP+ RTV+ SQV 50
3 ABC+ D4T+ NVP+ NFV 35
4 ABC+ D4T+ NVP+ LPV 1
5 None 15
6 ABC+ D4T+ NFV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10R, I15V, L19I, K20M, M36I, R41K, L63P, H69K, K70R, L89M, I93L  
>TK4004| codons 1-99
PQITLWQRPRVTIKVGGQIMEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, T69D, K70R, T215Y K219E Y181C A98G V35T, E36A, T39E, S48T, V60I, D121Y, K122E, S163SI, K173T, D177E, V179I, T200A, Q207E, L228R, V245Q, E291D, V292I, I293V  
>TK4004| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEELEKEGKITKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSIMTKILEPFRTQNPEIII
CQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFYTPDEKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005