<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK4003 TK4003a Denmark 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ NFV 215

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V L33I, N83D L10V, I13V, K14R, G16E, A22V, E35D, M36I, R41K, K45R, L63T, H69R, K70R, L89I  
>TK4003a| codons 1-99
PQITLWQRPVVTVRIEGQLKEVLLDTGADDTVIEDINLPGKWKPRMIGGIGGFVKVRQYD
QITIEICGRRAIGTVLVGPTPVDIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F       V35T, K122E, D123S, I135V, I142V, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S, F214L, V245Q, D250E, S251X, A272AP, K275KQ, T286A, E291D, V292I, I293V, E312D T216TR
>TK4003a| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGLFRPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKEXWTVNDIQKLVGKLNWASQIYPGIQVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKDPVHGVYYD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005