<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3035 TK3035 Denmark 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ IDV 39
2 AZT+ IDV+ 3TC 65
3 D4T+ DDI+ NFV+ NVP 27
4 D4T+ DDI+ NFV 34
5 None 4
6 ABC+ DDI+ EFV+ IDV+ RTV 37

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, L210W, T215Y K219E K101E, G190A K238T V35T, E36A, T39E, V60I, K122E, D123S, I135T, E138A, R172RK, K173T, Q174K, T200A, E203K, Q207E, R211K, D218DE, V245Q, E248D, A272P, K275R, Q278H, E291D, V292I, I293V, V317VG, Y319X G316E
>TK3035| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKTKNPDIVI
YQYMDDLYVASDLEIGQHRAKIKELREHLWKWGFYTPEEKHQKEPPFLWMGYELHPDTWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHEGYXDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82A   L10I, T12S, I15V, L19I, K20R, E35D, M36I, R41K, K45KR, D60E, L63P, H69K, A71V, L89M, I93L  
>TK3035| codons 1-99
PQITLWQRPIVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFAKVRQYE
QIPIEICGKKVIGTVLVGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005