<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3031 TK3031 Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 121
2 D4T+ DDI+ NFV+ NVP 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103N   V35VI, T39D, V90VI, V118I, K122E, I135T, K173T, D177E, T200A, Q207E, R211K, V245Q, E248D, D250E, A272P, R284K, T286A, E291D, V292I, I293V, E297K  
>TK3031| codons 1-323
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICDELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTDIVPLTKEAE
LELAENREILKEPVHGVYYDPSK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I15V, L19I, K20T, E35G, M36I, R41K, L63S, H69K, T74A, L89M, I93L G51GR
>TK3031| codons 1-99
PQITLWQRPLVTIKVGGQITEALLDTGADNTVLEGINLPGKWKPKMIGGIRGFIKVRQYD
QISIEICGKKAIGAVLVGPTPVNIIGRDMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005