<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3030 TK3030a Denmark 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 89
2 AZT+ DDI+ NFV 223

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K70R D67DG, T215TI, K219Q     V35T, T39I, V60I, K64KN, T69N, D121Y, K122E, I135T, K173S, Q174K, D177E, V179I, Q197E, Q207A, R211NS, V245K, D250E, A272T, T286A, I293V, P294T, L295LM, E312D  
>TK3030a| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICIELEKEGKISKIGPENPYNTPI
FAINKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGEHRTKIEELRAHLLNWGFITPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYTGIKVKQLCKLLRGAKALTEVVTMTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IL, L90LM   I13V, K20RT, E35D, M36I, N37NT, R41K, K45KR, R57K, H69K, A71AV, L89I, I93IM  
>TK3030a| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDITLPGKWKPRMIGGIGGFLKVKQYD
QILIEICGKKVIGTVLVGPTPVNIIGRNIMTQMGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005