<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3030 TK3030 Denmark 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 89
2 AZT+ DDI+ NFV 161

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K70R T215I, K219Q     V35T, T39I, V60I, T69N, D121Y, K122E, I135T, K173S, Q174K, D177E, V179I, Q197E, Q207A, R211N, V245K, D250E, A272T, T286A, I293V, P294T, L295LM, E312D  
>TK3030| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICIELEKEGKISKIGPENPYNTPI
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGEHRTKIEELRAHLLNWGFITPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYTGIKVKQLCKLLRGAKALTEVVTMTEEAE
LELAENREILKDPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, N37NT, R41K, K45R, R57K, H69K, L89M, I93IM  
>TK3030| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDITLPGKWKPRMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQMGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005