<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3029 TK3029a Denmark 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 106
2 D4T+ DDI+ NFV 26
3 D4T+ NFV+ 3TC 17
4 D4T+ ABC+ EFV 59
5 D4T+ ABC+ 3TC 10
6 D4T+ ABC+ 3TC+ LPV 58

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, T7S, V35T, K49R, V60I, V90I, K122E, D123S, I135T, S162D, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S, V245E, D250E, A272G, T286A, E291D, I293V, P294T T131TA
>TK3029a| codons 1-301
PISPIDSVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFAIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGAKALTDVVTLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>TK3029a| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005