<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3029 TK3029 Denmark 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 106
2 D4T+ DDI+ NFV 26
3 D4T+ NFV+ 3TC 17
4 D4T+ ABC+ EFV 50

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210LW, T215F V75M, K219Q K103N, G190A   E6D, K20R, V35T, K49R, V60I, V90I, I94L, S117A, K122E, D123S, I135T, S162D, K173S, Q174K, D177E, V179I, Q207A, R211N, D218E, L228H, V245K, D250E, A272G, T286A, E291D, I293V, P294T, E312D  
>TK3029| codons 1-324
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKEGKISRIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEIQLGLPHPAGLKKNKSVTVLDVGDAYFAVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRSKNPEIII
YQYMDDLYVASDLEIGQHRTKIEELRAHLWNWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKDPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10V, I13V, K20T, E35D, M36I, R41K, H69K, T74S, L89I  
>TK3029| codons 1-98
PQITLWQRPVVTVKIGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNIMTQIGCTLN

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005