<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3028 TK3028a Denmark 2001 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 10
2 3TC+ AZT+ NFV 176

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L89V I13V, K20T, E35D, M36I, N37NY, R41K, H69K, A71T  
>TK3028a| codons 1-99
PQITLWQRPLVTVKIGGQLTEALLDTGADDTVLEDIYLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKTIGTVLVGPTPVNIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E6D, V35T, E36EA, T39K, K43E, D121H, K122E, D123S, K173R, Q174K, D177E, T200A, E203D, Q207A, R211S, F214FL, K238R, V245EK, E291D, V292I, I293V, K311R, E312T, D320DE, P321X L246LR
>TK3028a| codons 1-324
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIDELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIERPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILRTPVHGVYYEXSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005