<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3025 TK3025 Denmark 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ DDI+ SQV 19
2 None 36
3 3TC+ DDI+ RTV 11
4 3TC+ DDI+ NFV 135
5 None 6
6 3TC+ AZT+ EFV 4
7 None 21
8 3TC+ ABC+ AZT 31
9 None 2
10 3TC+ ABC+ AZT 27
11 None 1
12 3TC+ ABC+ AZT 53

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, L19I, M36I, R41K, H69K, L89M, I93L  
>TK3025| codons 1-99
PQITLWQRPLVSIKVEGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, E36A, T39E, S48T, S68SR, K122E, I135T, S162X, K173A, Q174X, D177E, T200A, Q207E, R211K, F214FL, V241L, V245Q, A272P, R284RK, E291D, V292I, I293V, P294T  
>TK3025| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDRTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQXSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
LQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGTKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005