<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1838 CA4941 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 148
2 AZT+DDC 61
3 D4T+DDI 113
4 3TC+D4T+SQV 30
5 3TC+D4T+IDV 82
6 DDI+DLV+NFV+SQV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, K20I, E35D, N37S, I62V, L63P, A71I, I93L  
>CA4941| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEDMSLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKIISTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, L210W, T215Y   K103N   K20R, V35IM, K102Q, K122E, S162C, T200A, E203K, Q207E, R211K, K223E, K277R, A288S, I293V K154K*, T286AG
>CA4940| codons 1-295
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGW*GSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIKELREHLWKWGFYTPDKKHQEEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGGKSLTEVVPL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005