<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3024 TK3024 Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 76
2 D4T+ DDI+ NFV 129

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       K22X, V35T, E36A, T39E, S48T, V118VI, K122E, K166R, K173A, Q174K, D177E, T200A, Q207E, R211K, V245Q, A272P, K277R, T286A, E291D, V292I K13KM, L26LF
>TK3024| codons 1-324
PISPIETVPVKLMPGMDGPKVXQWPFTEEKIKALTAICEELEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, I15V, L19I, K20T, E35D, M36I, R41K, K45R, L63P, H69K, A71I, T74S, I93L  
>TK3024| codons 1-99
PQITLWQRPLVSIKVGGQITEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QIPIEICGKKIIGSVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005