<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3023 TK3023 Denmark 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ RTV 221

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L33F I13V, L19T, K20R, E35ED, M36I, R41K, L63V, I64V  
>TK3023| codons 1-99
PQITLWQRPLVTVKIGGQTREALLDTGADDTVFEDINLPGKWKPKMIGGIGGFVKVRQYD
QIVVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, K49R, V60I, D121Y, K122E, K173A, Q174K, D177E, I178M, V179I, I195T, Q207E, V245T, D250E, A272P, K277R, L282C, I293V, H315Q, V317M K13R
>TK3023| codons 1-320
PISPIETVPVKLRPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEMII
YQYVDDLYVGSDLETGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCLRGTKALTEVVPLTEEAE
LELAENREILKEPVQGMYYD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005