<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3022 TK3022 Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ SQV 20
2 None 29
3 3TC+ AZT+ SQV 52
4 3TC+ D4T+ NFV 31
5 3TC+ AZT+ EFV 57
6 None 13
7 3TC+ AZT+ EFV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, E35D, M36I, K43R, L63T, H69K, L89M, L97LI  
>TK3022| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEDINLPGRWRPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTINF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E G190S   K22KR, V35M, T39E, S48T, V90I, K101KQ, K122E, D123S, A158S, K173T, Q174K, D177E, I178L, V179VI, I195L, T200A, V245Q, S251I, A272P, K275R, L283I, E291D, V292I, I293V  
>TK3022| codons 1-324
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALMEICEEMEKEGKITKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRTKNPELII
YQYVDDLYVSSDLELGQHRAKIEELRQHLLRWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDIWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLIRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005