<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3020 TK3020 Denmark 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ RTV 57
2 3TC+ D4T+ NFV 14
3 3TC+ D4T+ SQV 18
4 D4T+ SQV+ DDI 31
5 DDI+ ABC+ EFV 17

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, R41K, L63AT, H69K, T74S, L89I, I93L  
>TK3020| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAIGSVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74V K219Q G190GE   V35T, E36A, T39E, S48T, V60I, K122E, D123N, I135T, S162Y, K173A, Q174K, D177E, V179VA, T200A, E203K, Q207E, R211K  
>TK3020| codons 1-219
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRAKNPEIAI
YQYMDDLYVESDLEIGQHRAKIKELREHLLKWGFTTPDQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005