<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3019 TK3019a Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ SQV 61
2 AZT+ NFV+ NVP 2
3 None 12
4 3TC+ AZT+ NFV 29
5 ABC+ EFV+ RTV+ SQV 57
6 ABC+ D4T+ DDI 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S, T74AP I15V, L19I, E35D, M36I, R41K, I62V, L63P, H69T, A71V, I72L, I93L  
>TK3019a| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGTKVLSAVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, T215F K219W L100I, K103N A98G V35T, T39A, E44D, S48T, V60I, S117A, V118I, K122E, D123S, K173A, G196E, T200A, E203V, Q207E, H208Y, W212G, D218E, L228H, V245Q, A272P, K277R, E291D, V292I, I293V G213W
>TK3019a| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKDGKITKIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPGGIKKNKSVTVLDVGDAYFAIPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIVELREYLLRGWFFTPEWKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005