<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3019 TK3019 Denmark 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ SQV 61
2 AZT+ NFV+ NVP 2
3 None 12
4 3TC+ AZT+ NFV 29
5 ABC+ EFV+ RTV+ SQV 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84IV, L90M V11VI, G73S L10I, I13V, I15V, L19I, K20R, E35D, M36I, R41K, K45R, I62V, L63P, H69T, A71V, I72L, I93L  
>TK3019| codons 1-99
PQITLWQRPIITVKVGGQIREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFVKVRQYD
QVPIEICGTKVLSTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, M184V, T215Y   L100I, K103N A98G D17DE, V35T, T39A, E44D, S48T, V60I, K122E, D123S, K173A, Q174R, G196K, T200A, Q207E, H208Y, W212M, D218E, V245Q, A272P, K277R, E291D, V292I, I293V G18GV
>TK3019| codons 1-324
PISPIETVPVKLKPGMEVPKVKQWPLTEEKIKALTEICAELEKDGKITKIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPGGIKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRARNPDIVI
YQYVDDLYVGSDLEIKQHRAKIEELREYLLRMGFYTPEKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005