<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3016 TK3016 Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 93
2 D4T+ DDI+ NFV 12
3 NFV+ 3TC+ AZT 1
4 3TC+ AZT+ SQV 61
5 3TC+ AZT+ EFV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M T74P L10V, I15V, E35D, M36I, R41K, H69K, A71V, L89M, I93L  
>TK3016| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QILIEICGKKVIGPVLVGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N, V106M   E6A, V35T, E36A, T39E, A98S, K122E, D123S, I135T, A158S, K173A, D177E, E203D, Q207E, R211K, D218E, V245Q, D250E, A272P, V276I, K277R, T286A, E291D, V292I, I293V  
>TK3016| codons 1-324
PISPIATVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIDELREHLLKWGFTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005