<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3015 TK3015c Denmark 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 43
2 AZT+ DDC+ IDV 173
3 ABC+ EFV+ LPV 126
4 ABC+ EFV+ LPV+ RTV+ NVP+ TDF+ TPV 27
5 ABC+ EFV+ LPV+ RTV+ TDF+ TPV 1
6 ABC+ EFV+ LPV 2
7 ABC+ EFV+ LPV+ RTV+ TDF+ TPV 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, I84IV, L90M K43T L10I, T12S, I15V, L19I, K20IR, E35D, M36I, R41K, D60E, Q61E, L63P, H69K, A71V, I85V, L89LM, I93L  
>TK3015c| codons 1-99
PQITLWQRPIVSIKVGGQIIEALLDTGADDTVLEDINLPGKWTPKMIGGIGGFVKVRQYE
EIPIEICGKKVIGTVLVGPTPTNVVGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R V106M V179D, F227L E6K, V35M, T39D, E44D, K102KR, V118I, K122E, I135L, K173A, Q174KR, N175NY, D177E, V189VI, E194K, G196E, T200A, I202V, Q207E, R211K, V245Q, D250E, A272S, K281KR, T286A, E291D, V292I, I293V, H315F  
>TK3015c| codons 1-333
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALMEICDELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSMTVLDVGDAYFSIPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKYPEIDI
YQYMDDLYIGSDLKIEQHRAKVEELREHLWKWGFYTPDRKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYSGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKEPVFGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005