<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3015 TK3015a Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 43
2 AZT+ DDC+ IDV 173
3 ABC+ EFV+ LPV 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   V106M V179D V35M, T39D, E44D, V118I, K122E, I135L, K173A, Q174K, N175Y, D177E, E194K, G196E, T200A, I202V, Q207E, R211K, V245Q, D250E, I257V, A272S, K281R, T286A, E291D, V292I, I293V, H315X, I329X  
>TK3015a| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICDELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSIPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKYPEIDI
YQYMDDLYVGSDLKIEQHRAKVEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDVQKLVGKLNWASQIYSGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKEPVXGVYYDPSKDLIAEMQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L10F, K43T T12S, I15V, L19K, K20I, E35D, M36I, R41K, D60E, Q61E, L63P, H69K, A71V, I85V, I93L  
>TK3015a| codons 1-99
PQITLWQRPFVSIKVGGQKIEALLDTGADDTVLEDINLPGKWTPKMIGGIGGFVKVRQYE
EIPIEICGKKVIGTVLVGPTPANIVGRNLMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005