<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3013 TK3013 Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDC+ SQV 85
2 D4T+ 3TC+ NFV+ NVP 19
3 D4T+ 3TC+ NFV 101

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10V, R41K, L63P, A71I, V77I, L89M, I93L  
>TK3013| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKIISTVLIGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     K20R, V35T, E40D, K49R, V60I, T69N, K122E, D123X, I135V, K166R, K173T, D177E, T200A, I202V, Q207D, V245Q, A272P, K277R, E291D, V292I, I293V, E297A  
>TK3013| codons 1-321
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEXFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTQNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELRDHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005