<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3010 TK3010a Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDC+ SQV 36
2 None 30
3 D4T+ DDI+ NFV 30
4 D4T+ NFV+ 3TC 32
5 ABC+ EFV+ IDV+ RTV 36
6 ABC+ EFV+ LPV 50
7 ABC+ 3TC+ AZT+ NFV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R V75I, K219Q L100I, K103N A98G V35T, E36A, T39D, S48T, V60I, K122E, D123G, I135V, S162C, K166KR, K173T, Q174K, D177E, I178L, T200A, E203K, Q207E, R211K, V245Q, A272P, V292I, I293V, K311R, V317A, Q334H, G335D, Q340X, Y342X  
>TK3010a| codons 1-342
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPI
FAIKKKNSDRWRKLIDFRELNKRTQDFWEVQLGIPHPGGIKKNKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILEPFRTKNPELVI
YQYMDDLYVGSDLEIGQHRAKIKELREHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIVPLTEEAE
LELAENREILREPVHGAYYDPSKDLIAEIQKQGHDQWTYXIX

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20T, E35ED, M36I, R41K, L63P, H69K, L89M, I93L  
>TK3010a| codons 1-99
PQITLWQRPLVSIKVGGQITEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005