<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3009 TK3009b Denmark 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 66
2 D4T+ DDI+ NFV 128
3 3TC+ ABC+ AZT 4
4 None 3
5 AZT+ EFV+ LPV 38
6 None 15
7 3TC+ ABC+ AZT 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13IV, K20R, E35D, M36I, N37D, R41K, L63P, H69K, T74S, L89M, I93L  
>TK3009b| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGSVLVGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y       V35T, E36A, T39E, S48T, K122E, D123N, A158S, K173A, D177E, T200A, Q207E, R211RK, V245Q, E248D, D250E, A272P, K277R, T286A, E291D, V292I, I293V, E297A, K311R, I329V  
>TK3009b| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILREPVHGVYYDPSKDLIAEVQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005