<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3009 TK3009 Denmark 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 66
2 D4T+ DDI+ NFV 92

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V       V35T, E36A, T39E, S48T, K122E, D123N, A158S, K173A, D177E, T200A, Q207E, Q222X  
>TK3009| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHXKEPPFLWMGYELHPD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   K20R, E35D, M36I, N37D, R41K, L63P, H69K, T74S, L89M, I93L  
>TK3009| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGSVLVGPTPVNIIGRNMMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005