<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3008 TK3008 Denmark 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 98
2 3TC+ AZT+ NFV 246

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V N83D L10I, I13V, A22V, M36I, R41K, I62V, L63P, I64V, H69HY  
>TK3008| codons 1-99
PQITLWQRPIVTVKIGGQLKEVLLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVPVEICGYKAIGTVLVGPTPVDVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     P225H V35T, T39A, V60VI, D121CY, K122E, D123DE, I135IL, I142V, D177E, I178M, T200I, Q207E, R211K, F214X, V245E, E248D, D250DE, A272P, K277R, L282C, I293V, E297K, Q334QH Q91QH
>TK3008| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVHLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
CEEFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGXTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIELPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGH

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005