<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3007 TK3007c Denmark 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 ABC+ D4T+ DDI 12
2 None 9
3 3TC+ AZT+ IDV+ RTV 58
4 3TC+ AZT+ EFV 46

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, V106M F227FL E28A, V35T, T39A, S48T, R83RK, K122E, D123S, S162A, K173T, D177E, T200A, Q207E, P243T, V245Q, E291D, V292I, I293V  
>TK3007c| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  N83ND, L89MV T12S, I15V, L19IM, E34A, M36I, R41K, L63P, H69K, I93L  
>TK3007c| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLAEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVDIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005