<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3006 TK3006a Denmark 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ RTV 177
2 D4T+ NFV+ NVP 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   T27S, V35T, V60I, D121Y, K122E, I135T, T139TI, D177E, T200I, Q207E, R211K, F214L, H221HY, V245E, D250E, A272P, K277R, L282C, L283I, R284K P52PL, L303LR
>TK3006a| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTEICTEMEKEGKISKIGLENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIKGTKALTEVIPLTEEAE
LERAENREILKEPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, L90M L33F I13V, I15V, R41K, I64V  
>TK3006a| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVFEEMNLPGKWKPKMIGGIGGFVKVRQYD
QILVEICGHKAIGTVLVGPTPFNIIGRNLMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005