<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3006 TK3006 Denmark 2000 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ RTV 157

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82F, L90M L33F I13V, I15V, R41K, I62IV I64GV
>TK3006| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVFEEMNLPGKWKPKMIGGIGGFVKVRQYD
QVLGEICGHKAIGTVLVGPTPFNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, V60I, D121Y, K122E, I135T, D177E, I178IM, T200I, Q207E, R211K, F214L, V245E, D250E, A272P, K277R, L282C, L283I, R284RK  
>TK3006| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIKGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005