<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK3002 TK3002a Denmark 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ RTV+ SQV 55
2 None 16
3 3TC+ AZT+ RTV+ SQV 65
4 3TC+ AZT+ RTV+ IDV 87

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, L19P, K20I, E35ED, M36I, R41K, H69K, K70R, L89M  
>TK3002a| codons 1-99
PQITLWQRPIVTVKIGGQPIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K219KN     V35T, E36D, V60VI, I135V, S162A, K173T, Q174K, D177E, T200X, E203D, Q207D, R211K, P243T, V245E, E248D, K281R, T286A, E291D, V292I, I293V, P294PT, S322A P226PR
>TK3002a| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRXKIDELRDHLLKWGFTTPDNKHQKEPRFLWMGYELHPDKWT
VQTIELPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005