<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2029 TK2029 Denmark 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 AZT+ 3TC 82
3 3TC+ D4T+ IDV 39
4 3TC+ D4T+ ABC 201

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219E   A98G V35T, T39A, V60I, S117X, K122E, D123S, I135T, I167V, K173S, Q174K, D177E, V179I, T200A, E203D, Q207A, R211NS, L228H, Q242H, V245T, D250E, T286A, E291D, I293V, P294T, E312D  
>TK2029| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFXVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRSKNPEIII
YQYVDDLYVGSDLEIGQHRAKIDELRAHLLNWGFFTPDEKHQKEPPFHWMGYELHPDKWT
VHPITLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKDPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, G16GE, E35D, M36I, R41K, K45R, R57K, L63P, H69K, V77I, L89M  
>TK2029| codons 1-99
PQITLWQRPIVTVRIEGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005