<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2028 TK2028 Denmark 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 21
2 AZT+ DDI+ IDV 8
3 AZT+ IDV+ 3TC 43
4 3TC+ D4T+ RTV+ SQV 156
5 3TC+ ABC+ DDI+ EFV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, L90LM L23I, F53L, N88ND K14KR, E35ED, N37P, L63P, A71AV  
>TK2028| codons 1-99
PQITLWQRPLVTIRIGGQLKEAILDTGADDTVLEDMPLPGRWKPKIIGGIGGLVKVRQYD
QIPIEICGHKVIGTVLVGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, T215Y   L100I, K103N V108VI V35L, T39A, D123E, K173R, D177E, H221Y, A272P, K277R, E297K K219A
>TK2028| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDAKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYY

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005