<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2025 TK2025a Denmark 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 8
2 None 31
3 3TC+ D4T+ IDV 25
4 IDV 7
5 3TC+ ABC+ D4T+ RTV 1
6 3TC+ ABC+ D4T+ RTV+ NVP+ SQV 5
7 None 3
8 3TC+ ABC+ D4T+ NVP+ RTV+ SQV 105
9 ABC+ D4T+ DDC+ DDI+ EFV+ LPV 196

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, M36I, R41K, D60E, L63T, I64V, I72V  
>TK2025a| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QITVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V   K101E, Y181C, G190A   K32R, V35R, K43N, V60I, V118I, K122E, I135T, D177E, T200I, Q207E, R211K, V245K, D250E, A272P, L282C, R284K, T286A, I293V, E297A, P321PQ  
>TK2025a| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALREICTELENEGKISKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVASDLEIGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCLKGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDQSKDLIAEIQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005