<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2025 TK2025 Denmark 2000 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 8
2 None 31
3 3TC+ D4T+ IDV 25
4 IDV 7
5 3TC+ ABC+ D4T+ RTV 1
6 3TC+ ABC+ D4T+ RTV+ NVP+ SQV 5
7 None 3
8 3TC+ ABC+ D4T+ NVP+ RTV+ SQV 105

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V   K101E, Y181C, G190A   K32R, V35M, E42EG, K43N, V60I, K122E, I135T, D177E, T200I, Q207E, R211K, V245EK, D250E, A272P, L282C, R284K, T286A, I293V, E297A  
>TK2025| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALMEICTEMGNEGKISKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVASDLEIGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCLKGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005