<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2024 TK2024b Denmark 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 48
2 None 13
3 3TC+ D4T+ IDV 72
4 3TC+ IDV+ AZT+ DDI+ EFV+ RTV 91
5 3TC+ AZT+ DDI+ EFV+ RTV+ SQV 5
6 None 14
7 3TC+ AZT+ DDI+ EFV+ RTV+ SQV 59
8 None 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, V106M, G190A   V35T, E36A, T39E, W88C, K122E, D123S, E138A, K173T, Q174K, D177E, T200P, Q207N, R211K, F214L, V245Q, S268C, A272P, K275R, E291D, V292I, I293V, V317A L209LV
>TK2024b| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLEKKKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVASDLEIGQHRPKIEELRNHVLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWACQIYPGIRVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, N37ND, R41RK, L63LP, H69K, L89M, I93IL  
>TK2024b| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005