<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2024 TK2024a Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 48
2 None 13
3 3TC+ D4T+ IDV 72
4 3TC+ IDV+ AZT+ DDI+ EFV+ RTV 91
5 3TC+ AZT+ DDI+ EFV+ RTV+ SQV 5
6 None 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, N37D, L63LP, H69K, L89M, I93IL L97Q
>TK2024a| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTQNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   V106M   V35T, E36A, T39E, W88C, K122E, D123S, E138A, K173T, Q174K, D177E, T200A, Q207N, R211K, V245Q, S268C, A272P, K275R, Q278X, E291D, V292I, I293V  
>TK2024a| codons 1-316
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWACQIYPGIRVKXLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005