<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2024 TK2024 Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 48
2 None 13
3 3TC+ D4T+ IDV 72
4 3TC+ IDV+ AZT+ DDI+ EFV+ RTV 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V       V35T, E36D, T39E, W88C, K122E, D123S, E138A, K173T, D177E, I178L, T200A, Q207K, H208Y, R211K, V245Q, L246X, A272P, K275R, V292I, I293V, V317A, D320DE  
>TK2024| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICEELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPELVI
YQYVDDLYVGSDLEIGQHRAKIEELRKYLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQXPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGTKALTEIVPLTEEAE
LELAENREILKEPVHGAYYEPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35DN, M36I, N37DE, P39PS, R41K, H69K, L89M  
>TK2024| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDIDLSGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005