<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2023 TK2023 Denmark 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+ DDI 26
3 AZT+ DDI+ RTV 4
4 AZT+ RTV+ 3TC 8
5 AZT+ 3TC 8
6 3TC+ D4T+ IDV 78
7 D4T+ DDI+ NVP+ RTV+ SQV 17
8 D4T+ DDI+ NVP+ RTV 52
9 D4T+ DDI+ NVP+ RTV+ SQV 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, L19I, M36I, R41K, L63V, H69K, T74S, V75I, L89M, I93L  
>TK2023| codons 1-99
PQITLWQRPIVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGSILVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L210LW, T215CY K219E Y181C   V35T, T39E, S48T, K49KR, K122E, K173I, Q174K, D177E, T200A, Q207E, H208HY, R211K, H221HY, V245Q, A272P, K277R, T286A, E291D, V292I, I293V  
>TK2023| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEELREYLWKWGFCTPDEKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005